Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 5119465..5119686 | Replicon | chromosome |
| Accession | NZ_CP040313 | ||
| Organism | Escherichia coli strain M7638 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | FEL02_RS25265 | Protein ID | WP_001295224.1 |
| Coordinates | 5119465..5119572 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 5119621..5119686 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEL02_RS25240 | 5114718..5115470 | - | 753 | Protein_4912 | cellulose biosynthesis protein BcsQ | - |
| FEL02_RS25245 | 5115482..5115670 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| FEL02_RS25250 | 5115943..5117514 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| FEL02_RS25255 | 5117511..5117702 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| FEL02_RS25260 | 5117699..5119378 | + | 1680 | WP_000191592.1 | cellulose biosynthesis protein BcsG | - |
| FEL02_RS25265 | 5119465..5119572 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 5119621..5119686 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 5119621..5119686 | + | 66 | NuclAT_21 | - | Antitoxin |
| FEL02_RS25270 | 5120048..5121319 | + | 1272 | WP_001301684.1 | amino acid permease | - |
| FEL02_RS25275 | 5121349..5122353 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| FEL02_RS25280 | 5122350..5123333 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| FEL02_RS25285 | 5123344..5124246 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T125472 WP_001295224.1 NZ_CP040313:c5119572-5119465 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T125472 NZ_CP040313:c5119572-5119465 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT125472 NZ_CP040313:5119621-5119686 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|