Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2867595..2867820 | Replicon | chromosome |
Accession | NZ_CP040313 | ||
Organism | Escherichia coli strain M7638 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | FEL02_RS13955 | Protein ID | WP_000935259.1 |
Coordinates | 2867595..2867807 (-) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2867762..2867820 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL02_RS13905 | 2862598..2863029 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
FEL02_RS13920 | 2863480..2864193 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
FEL02_RS13925 | 2864329..2864526 | - | 198 | WP_000917763.1 | hypothetical protein | - |
FEL02_RS13930 | 2864751..2865305 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
FEL02_RS13935 | 2865368..2865673 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
FEL02_RS13940 | 2865686..2866735 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
FEL02_RS13945 | 2866737..2867009 | - | 273 | WP_000191872.1 | hypothetical protein | - |
FEL02_RS13950 | 2867131..2867475 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
FEL02_RS13955 | 2867595..2867807 | - | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2867762..2867820 | + | 59 | - | - | Antitoxin |
FEL02_RS13960 | 2868041..2868598 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
FEL02_RS13965 | 2868600..2868818 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
FEL02_RS13970 | 2868946..2869257 | - | 312 | WP_001289673.1 | hypothetical protein | - |
FEL02_RS13975 | 2869250..2869477 | - | 228 | WP_000699809.1 | hypothetical protein | - |
FEL02_RS13980 | 2869474..2869755 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
FEL02_RS13985 | 2869788..2870504 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
FEL02_RS13990 | 2870538..2870999 | - | 462 | WP_000139447.1 | replication protein | - |
FEL02_RS13995 | 2870992..2872035 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
FEL02_RS14000 | 2872104..2872529 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
FEL02_RS14005 | 2872513..2872755 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | espM1 / nleA/espI | 2830493..2947405 | 116912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T125453 WP_000935259.1 NZ_CP040313:c2867807-2867595 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T125453 NZ_CP040313:c2867807-2867595 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT125453 NZ_CP040313:2867762-2867820 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|