Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 5104787..5105008 | Replicon | chromosome |
Accession | NZ_CP040311 | ||
Organism | Escherichia coli strain F3398 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | FEL04_RS24975 | Protein ID | WP_001295224.1 |
Coordinates | 5104787..5104894 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 5104943..5105008 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL04_RS24950 | 5100040..5100792 | - | 753 | Protein_4853 | cellulose biosynthesis protein BcsQ | - |
FEL04_RS24955 | 5100804..5100992 | - | 189 | WP_001063316.1 | YhjR family protein | - |
FEL04_RS24960 | 5101265..5102836 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
FEL04_RS24965 | 5102833..5103024 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
FEL04_RS24970 | 5103021..5104700 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
FEL04_RS24975 | 5104787..5104894 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5104943..5105008 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5104943..5105008 | + | 66 | NuclAT_21 | - | Antitoxin |
FEL04_RS24980 | 5105370..5106641 | + | 1272 | WP_001301684.1 | amino acid permease | - |
FEL04_RS24985 | 5106671..5107675 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
FEL04_RS24990 | 5107672..5108655 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
FEL04_RS24995 | 5108666..5109568 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T125431 WP_001295224.1 NZ_CP040311:c5104894-5104787 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T125431 NZ_CP040311:c5104894-5104787 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT125431 NZ_CP040311:5104943-5105008 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|