Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2852378..2852603 | Replicon | chromosome |
| Accession | NZ_CP040311 | ||
| Organism | Escherichia coli strain F3398 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | FEL04_RS13645 | Protein ID | WP_000935259.1 |
| Coordinates | 2852378..2852590 (-) | Length | 71 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2852545..2852603 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEL04_RS13595 | 2847381..2847812 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| FEL04_RS13610 | 2848263..2848976 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| FEL04_RS13615 | 2849112..2849309 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| FEL04_RS13620 | 2849534..2850088 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| FEL04_RS13625 | 2850151..2850456 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FEL04_RS13630 | 2850469..2851518 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| FEL04_RS13635 | 2851520..2851792 | - | 273 | WP_000191871.1 | hypothetical protein | - |
| FEL04_RS13640 | 2851914..2852258 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| FEL04_RS13645 | 2852378..2852590 | - | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2852545..2852603 | + | 59 | - | - | Antitoxin |
| FEL04_RS13650 | 2852824..2853381 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| FEL04_RS13655 | 2853383..2853601 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| FEL04_RS13660 | 2853729..2854040 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| FEL04_RS13665 | 2854033..2854260 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| FEL04_RS13670 | 2854257..2854538 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| FEL04_RS13675 | 2854571..2855287 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| FEL04_RS13680 | 2855321..2855782 | - | 462 | WP_000139447.1 | replication protein | - |
| FEL04_RS13685 | 2855775..2856830 | - | 1056 | WP_001356791.1 | hypothetical protein | - |
| FEL04_RS13690 | 2856899..2857324 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| FEL04_RS13695 | 2857308..2857550 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 2814930..2909767 | 94837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T125412 WP_000935259.1 NZ_CP040311:c2852590-2852378 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T125412 NZ_CP040311:c2852590-2852378 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT125412 NZ_CP040311:2852545-2852603 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|