Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2423866..2424080 Replicon chromosome
Accession NZ_CP040311
Organism Escherichia coli strain F3398

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag FEL04_RS11515 Protein ID WP_000170963.1
Coordinates 2423866..2423973 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2424021..2424080 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FEL04_RS11485 2419175..2420257 + 1083 WP_000804726.1 peptide chain release factor 1 -
FEL04_RS11490 2420257..2421090 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
FEL04_RS11495 2421087..2421479 + 393 WP_000200379.1 invasion regulator SirB2 -
FEL04_RS11500 2421483..2422292 + 810 WP_001257044.1 invasion regulator SirB1 -
FEL04_RS11505 2422328..2423182 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
FEL04_RS11510 2423330..2423437 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2423490..2423551 + 62 NuclAT_24 - -
- 2423490..2423551 + 62 NuclAT_24 - -
- 2423490..2423551 + 62 NuclAT_24 - -
- 2423490..2423551 + 62 NuclAT_24 - -
- 2423490..2423551 + 62 NuclAT_26 - -
- 2423490..2423551 + 62 NuclAT_26 - -
- 2423490..2423551 + 62 NuclAT_26 - -
- 2423490..2423551 + 62 NuclAT_26 - -
- 2423490..2423551 + 62 NuclAT_28 - -
- 2423490..2423551 + 62 NuclAT_28 - -
- 2423490..2423551 + 62 NuclAT_28 - -
- 2423490..2423551 + 62 NuclAT_28 - -
- 2423490..2423551 + 62 NuclAT_30 - -
- 2423490..2423551 + 62 NuclAT_30 - -
- 2423490..2423551 + 62 NuclAT_30 - -
- 2423490..2423551 + 62 NuclAT_30 - -
- 2423490..2423551 + 62 NuclAT_32 - -
- 2423490..2423551 + 62 NuclAT_32 - -
- 2423490..2423551 + 62 NuclAT_32 - -
- 2423490..2423551 + 62 NuclAT_32 - -
- 2423490..2423552 + 63 NuclAT_17 - -
- 2423490..2423552 + 63 NuclAT_17 - -
- 2423490..2423552 + 63 NuclAT_17 - -
- 2423490..2423552 + 63 NuclAT_17 - -
- 2423490..2423552 + 63 NuclAT_18 - -
- 2423490..2423552 + 63 NuclAT_18 - -
- 2423490..2423552 + 63 NuclAT_18 - -
- 2423490..2423552 + 63 NuclAT_18 - -
- 2423490..2423552 + 63 NuclAT_19 - -
- 2423490..2423552 + 63 NuclAT_19 - -
- 2423490..2423552 + 63 NuclAT_19 - -
- 2423490..2423552 + 63 NuclAT_19 - -
- 2423490..2423552 + 63 NuclAT_20 - -
- 2423490..2423552 + 63 NuclAT_20 - -
- 2423490..2423552 + 63 NuclAT_20 - -
- 2423490..2423552 + 63 NuclAT_20 - -
- 2423490..2423552 + 63 NuclAT_22 - -
- 2423490..2423552 + 63 NuclAT_22 - -
- 2423490..2423552 + 63 NuclAT_22 - -
- 2423490..2423552 + 63 NuclAT_22 - -
- 2423490..2423552 + 63 NuclAT_23 - -
- 2423490..2423552 + 63 NuclAT_23 - -
- 2423490..2423552 + 63 NuclAT_23 - -
- 2423490..2423552 + 63 NuclAT_23 - -
FEL04_RS11515 2423866..2423973 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2424021..2424080 + 60 NuclAT_25 - Antitoxin
- 2424021..2424080 + 60 NuclAT_25 - Antitoxin
- 2424021..2424080 + 60 NuclAT_25 - Antitoxin
- 2424021..2424080 + 60 NuclAT_25 - Antitoxin
- 2424021..2424080 + 60 NuclAT_27 - Antitoxin
- 2424021..2424080 + 60 NuclAT_27 - Antitoxin
- 2424021..2424080 + 60 NuclAT_27 - Antitoxin
- 2424021..2424080 + 60 NuclAT_27 - Antitoxin
- 2424021..2424080 + 60 NuclAT_29 - Antitoxin
- 2424021..2424080 + 60 NuclAT_29 - Antitoxin
- 2424021..2424080 + 60 NuclAT_29 - Antitoxin
- 2424021..2424080 + 60 NuclAT_29 - Antitoxin
- 2424021..2424080 + 60 NuclAT_31 - Antitoxin
- 2424021..2424080 + 60 NuclAT_31 - Antitoxin
- 2424021..2424080 + 60 NuclAT_31 - Antitoxin
- 2424021..2424080 + 60 NuclAT_31 - Antitoxin
- 2424021..2424080 + 60 NuclAT_33 - Antitoxin
- 2424021..2424080 + 60 NuclAT_33 - Antitoxin
- 2424021..2424080 + 60 NuclAT_33 - Antitoxin
- 2424021..2424080 + 60 NuclAT_33 - Antitoxin
FEL04_RS11520 2424372..2425472 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
FEL04_RS11525 2425742..2425972 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FEL04_RS11530 2426133..2426828 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
FEL04_RS11535 2426872..2427225 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
FEL04_RS11540 2427411..2428805 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T125409 WP_000170963.1 NZ_CP040311:c2423973-2423866 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T125409 NZ_CP040311:c2423973-2423866 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT125409 NZ_CP040311:2424021-2424080 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References