Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1930825..1931050 | Replicon | chromosome |
Accession | NZ_CP040311 | ||
Organism | Escherichia coli strain F3398 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | FEL04_RS08870 | Protein ID | WP_000813263.1 |
Coordinates | 1930895..1931050 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1930825..1930883 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL04_RS08840 | 1926106..1927191 | + | 1086 | WP_072141648.1 | DNA-binding protein | - |
FEL04_RS08845 | 1927198..1927944 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
FEL04_RS08850 | 1927966..1928736 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
FEL04_RS08855 | 1928752..1929165 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
FEL04_RS08860 | 1929517..1930290 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1930825..1930883 | - | 59 | - | - | Antitoxin |
FEL04_RS08870 | 1930895..1931050 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
FEL04_RS08875 | 1931218..1931496 | + | 279 | WP_001341388.1 | hypothetical protein | - |
FEL04_RS08880 | 1931498..1932547 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
FEL04_RS08885 | 1932560..1932931 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
FEL04_RS08890 | 1932921..1933292 | + | 372 | WP_000090264.1 | antitermination protein | - |
FEL04_RS08895 | 1933444..1934262 | + | 819 | WP_153023022.1 | CPBP family intramembrane metalloprotease | - |
FEL04_RS08900 | 1934549..1934745 | + | 197 | Protein_1724 | TrmB family transcriptional regulator | - |
FEL04_RS08905 | 1934883..1935596 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T125405 WP_000813263.1 NZ_CP040311:1930895-1931050 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T125405 NZ_CP040311:1930895-1931050 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT125405 NZ_CP040311:c1930883-1930825 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|