Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2407086..2407300 Replicon chromosome
Accession NZ_CP040309
Organism Escherichia coli strain 21B8

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag FEK99_RS11585 Protein ID WP_000170963.1
Coordinates 2407086..2407193 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2407241..2407300 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FEK99_RS11555 2402395..2403477 + 1083 WP_000804726.1 peptide chain release factor 1 -
FEK99_RS11560 2403477..2404310 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
FEK99_RS11565 2404307..2404699 + 393 WP_000200379.1 invasion regulator SirB2 -
FEK99_RS11570 2404703..2405512 + 810 WP_001257044.1 invasion regulator SirB1 -
FEK99_RS11575 2405548..2406402 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
FEK99_RS11580 2406550..2406657 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2406710..2406771 + 62 NuclAT_24 - -
- 2406710..2406771 + 62 NuclAT_24 - -
- 2406710..2406771 + 62 NuclAT_24 - -
- 2406710..2406771 + 62 NuclAT_24 - -
- 2406710..2406771 + 62 NuclAT_26 - -
- 2406710..2406771 + 62 NuclAT_26 - -
- 2406710..2406771 + 62 NuclAT_26 - -
- 2406710..2406771 + 62 NuclAT_26 - -
- 2406710..2406771 + 62 NuclAT_28 - -
- 2406710..2406771 + 62 NuclAT_28 - -
- 2406710..2406771 + 62 NuclAT_28 - -
- 2406710..2406771 + 62 NuclAT_28 - -
- 2406710..2406771 + 62 NuclAT_30 - -
- 2406710..2406771 + 62 NuclAT_30 - -
- 2406710..2406771 + 62 NuclAT_30 - -
- 2406710..2406771 + 62 NuclAT_30 - -
- 2406710..2406771 + 62 NuclAT_32 - -
- 2406710..2406771 + 62 NuclAT_32 - -
- 2406710..2406771 + 62 NuclAT_32 - -
- 2406710..2406771 + 62 NuclAT_32 - -
- 2406710..2406772 + 63 NuclAT_17 - -
- 2406710..2406772 + 63 NuclAT_17 - -
- 2406710..2406772 + 63 NuclAT_17 - -
- 2406710..2406772 + 63 NuclAT_17 - -
- 2406710..2406772 + 63 NuclAT_18 - -
- 2406710..2406772 + 63 NuclAT_18 - -
- 2406710..2406772 + 63 NuclAT_18 - -
- 2406710..2406772 + 63 NuclAT_18 - -
- 2406710..2406772 + 63 NuclAT_19 - -
- 2406710..2406772 + 63 NuclAT_19 - -
- 2406710..2406772 + 63 NuclAT_19 - -
- 2406710..2406772 + 63 NuclAT_19 - -
- 2406710..2406772 + 63 NuclAT_20 - -
- 2406710..2406772 + 63 NuclAT_20 - -
- 2406710..2406772 + 63 NuclAT_20 - -
- 2406710..2406772 + 63 NuclAT_20 - -
- 2406710..2406772 + 63 NuclAT_22 - -
- 2406710..2406772 + 63 NuclAT_22 - -
- 2406710..2406772 + 63 NuclAT_22 - -
- 2406710..2406772 + 63 NuclAT_22 - -
- 2406710..2406772 + 63 NuclAT_23 - -
- 2406710..2406772 + 63 NuclAT_23 - -
- 2406710..2406772 + 63 NuclAT_23 - -
- 2406710..2406772 + 63 NuclAT_23 - -
FEK99_RS11585 2407086..2407193 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2407241..2407300 + 60 NuclAT_25 - Antitoxin
- 2407241..2407300 + 60 NuclAT_25 - Antitoxin
- 2407241..2407300 + 60 NuclAT_25 - Antitoxin
- 2407241..2407300 + 60 NuclAT_25 - Antitoxin
- 2407241..2407300 + 60 NuclAT_27 - Antitoxin
- 2407241..2407300 + 60 NuclAT_27 - Antitoxin
- 2407241..2407300 + 60 NuclAT_27 - Antitoxin
- 2407241..2407300 + 60 NuclAT_27 - Antitoxin
- 2407241..2407300 + 60 NuclAT_29 - Antitoxin
- 2407241..2407300 + 60 NuclAT_29 - Antitoxin
- 2407241..2407300 + 60 NuclAT_29 - Antitoxin
- 2407241..2407300 + 60 NuclAT_29 - Antitoxin
- 2407241..2407300 + 60 NuclAT_31 - Antitoxin
- 2407241..2407300 + 60 NuclAT_31 - Antitoxin
- 2407241..2407300 + 60 NuclAT_31 - Antitoxin
- 2407241..2407300 + 60 NuclAT_31 - Antitoxin
- 2407241..2407300 + 60 NuclAT_33 - Antitoxin
- 2407241..2407300 + 60 NuclAT_33 - Antitoxin
- 2407241..2407300 + 60 NuclAT_33 - Antitoxin
- 2407241..2407300 + 60 NuclAT_33 - Antitoxin
FEK99_RS11590 2407592..2408692 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
FEK99_RS11595 2408962..2409192 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FEK99_RS11600 2409353..2410048 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
FEK99_RS11605 2410092..2410445 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FEK99_RS11610 2410631..2412025 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T125365 WP_000170963.1 NZ_CP040309:c2407193-2407086 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T125365 NZ_CP040309:c2407193-2407086 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT125365 NZ_CP040309:2407241-2407300 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References