Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1951975..1952200 | Replicon | chromosome |
| Accession | NZ_CP040309 | ||
| Organism | Escherichia coli strain 21B8 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | FEK99_RS09050 | Protein ID | WP_000813263.1 |
| Coordinates | 1952045..1952200 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1951975..1952033 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEK99_RS09020 | 1947250..1948341 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| FEK99_RS09025 | 1948348..1949094 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| FEK99_RS09030 | 1949116..1949886 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| FEK99_RS09035 | 1949902..1950315 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| FEK99_RS09040 | 1950667..1951440 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 1951975..1952033 | - | 59 | - | - | Antitoxin |
| FEK99_RS09050 | 1952045..1952200 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| FEK99_RS09055 | 1952368..1952646 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| FEK99_RS09060 | 1952648..1953697 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| FEK99_RS09065 | 1953710..1954081 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FEK99_RS09070 | 1954071..1954442 | + | 372 | WP_000090264.1 | antitermination protein | - |
| FEK99_RS09075 | 1954594..1955412 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| FEK99_RS09080 | 1955699..1955895 | + | 197 | Protein_1762 | TrmB family transcriptional regulator | - |
| FEK99_RS09085 | 1956033..1956746 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T125362 WP_000813263.1 NZ_CP040309:1952045-1952200 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T125362 NZ_CP040309:1952045-1952200 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT125362 NZ_CP040309:c1952033-1951975 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|