Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 5262926..5263147 | Replicon | chromosome |
| Accession | NZ_CP040305 | ||
| Organism | Escherichia coli strain HB6 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | FEL06_RS26235 | Protein ID | WP_001295224.1 |
| Coordinates | 5262926..5263033 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 5263082..5263147 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEL06_RS26210 | 5258179..5258931 | - | 753 | Protein_5109 | cellulose biosynthesis protein BcsQ | - |
| FEL06_RS26215 | 5258943..5259131 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| FEL06_RS26220 | 5259404..5260975 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| FEL06_RS26225 | 5260972..5261163 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| FEL06_RS26230 | 5261160..5262839 | + | 1680 | WP_000191592.1 | cellulose biosynthesis protein BcsG | - |
| FEL06_RS26235 | 5262926..5263033 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 5263082..5263147 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 5263082..5263147 | + | 66 | NuclAT_22 | - | Antitoxin |
| FEL06_RS26240 | 5263509..5264780 | + | 1272 | WP_001301684.1 | amino acid permease | - |
| FEL06_RS26245 | 5264810..5265814 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| FEL06_RS26250 | 5265811..5266794 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| FEL06_RS26255 | 5266805..5267707 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T125315 WP_001295224.1 NZ_CP040305:c5263033-5262926 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T125315 NZ_CP040305:c5263033-5262926 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT125315 NZ_CP040305:5263082-5263147 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|