Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 45273..45537 | Replicon | plasmid pEc1500_CTX |
Accession | NZ_CP040270 | ||
Organism | Escherichia coli strain 1500 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | EST53_RS23200 | Protein ID | WP_001387489.1 |
Coordinates | 45385..45537 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 45273..45333 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EST53_RS23185 | 41375..42445 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
EST53_RS23190 | 42464..43672 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 43852..43909 | - | 58 | NuclAT_1 | - | - |
- | 43852..43909 | - | 58 | NuclAT_1 | - | - |
- | 43852..43909 | - | 58 | NuclAT_1 | - | - |
- | 43852..43909 | - | 58 | NuclAT_1 | - | - |
EST53_RS23195 | 43979..45070 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 45273..45333 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 45273..45333 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 45273..45333 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 45273..45333 | - | 61 | NuclAT_0 | - | Antitoxin |
EST53_RS23200 | 45385..45537 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
EST53_RS23205 | 45609..45860 | - | 252 | WP_001291964.1 | hypothetical protein | - |
EST53_RS23210 | 46160..46456 | + | 297 | WP_011264046.1 | hypothetical protein | - |
EST53_RS23655 | 46521..46697 | - | 177 | WP_001054900.1 | hypothetical protein | - |
EST53_RS23215 | 47089..47298 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
EST53_RS23220 | 47370..48032 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
EST53_RS23225 | 48103..50271 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..91123 | 91123 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T125266 WP_001387489.1 NZ_CP040270:45385-45537 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T125266 NZ_CP040270:45385-45537 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT125266 NZ_CP040270:c45333-45273 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|