Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2318692..2318876 | Replicon | chromosome |
Accession | NZ_CP040230 | ||
Organism | Staphylococcus aureus strain GD1108 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | FD491_RS11215 | Protein ID | WP_000482647.1 |
Coordinates | 2318692..2318799 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2318816..2318876 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FD491_RS11190 | 2314049..2314522 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
FD491_RS11195 | 2314645..2315856 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
FD491_RS11200 | 2316044..2316703 | - | 660 | WP_000831300.1 | hypothetical protein | - |
FD491_RS11205 | 2316763..2317905 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
FD491_RS11210 | 2318172..2318558 | + | 387 | WP_000779355.1 | flippase GtxA | - |
FD491_RS11215 | 2318692..2318799 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2318816..2318876 | - | 61 | - | - | Antitoxin |
FD491_RS11220 | 2319503..2321266 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
FD491_RS11225 | 2321291..2323024 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
FD491_RS11230 | 2323255..2323422 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T125111 WP_000482647.1 NZ_CP040230:2318692-2318799 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T125111 NZ_CP040230:2318692-2318799 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT125111 NZ_CP040230:c2318876-2318816 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|