Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2138370..2138587 | Replicon | chromosome |
Accession | NZ_CP040229 | ||
Organism | Staphylococcus aureus strain GD487 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FD482_RS10535 | Protein ID | WP_001802298.1 |
Coordinates | 2138483..2138587 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2138370..2138425 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FD482_RS10515 | 2134509..2135174 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
FD482_RS10520 | 2135326..2135646 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FD482_RS10525 | 2135648..2136628 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
FD482_RS10530 | 2136894..2137985 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2138370..2138425 | + | 56 | - | - | Antitoxin |
FD482_RS10535 | 2138483..2138587 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FD482_RS10540 | 2139267..2139425 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FD482_RS10545 | 2139861..2139953 | + | 93 | WP_000220902.1 | hypothetical protein | - |
FD482_RS10550 | 2140083..2140940 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
FD482_RS10555 | 2141008..2141790 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
FD482_RS10560 | 2142080..2142688 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T125102 WP_001802298.1 NZ_CP040229:c2138587-2138483 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T125102 NZ_CP040229:c2138587-2138483 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT125102 NZ_CP040229:2138370-2138425 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|