Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3932163..3932421 | Replicon | chromosome |
| Accession | NZ_CP040067 | ||
| Organism | Escherichia coli strain A1_181 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | FDP43_RS19175 | Protein ID | WP_000809168.1 |
| Coordinates | 3932269..3932421 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3932163..3932220 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FDP43_RS26075 | 3927217..3927993 | + | 777 | WP_166666977.1 | fimbria/pilus outer membrane usher protein | - |
| FDP43_RS26355 | 3928168..3928542 | + | 375 | WP_021521651.1 | hypothetical protein | - |
| FDP43_RS19160 | 3928555..3929513 | + | 959 | Protein_3710 | fimbrial family protein | - |
| FDP43_RS19165 | 3929552..3930451 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| FDP43_RS19170 | 3930517..3931683 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 3932163..3932220 | - | 58 | - | - | Antitoxin |
| FDP43_RS19175 | 3932269..3932421 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| FDP43_RS19180 | 3932525..3933655 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| FDP43_RS19185 | 3933744..3935660 | - | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
| FDP43_RS19190 | 3936037..3936441 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
| FDP43_RS19195 | 3936467..3937180 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T124868 WP_000809168.1 NZ_CP040067:3932269-3932421 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T124868 NZ_CP040067:3932269-3932421 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT124868 NZ_CP040067:c3932220-3932163 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|