Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2396376..2396560 | Replicon | chromosome |
Accession | NZ_CP039992 | ||
Organism | Staphylococcus aureus strain Lr3 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E1E63_RS12135 | Protein ID | WP_000482647.1 |
Coordinates | 2396453..2396560 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2396376..2396436 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1E63_RS12120 | 2391827..2391994 | - | 168 | Protein_2294 | hypothetical protein | - |
E1E63_RS12125 | 2392225..2393958 | - | 1734 | WP_000486506.1 | ABC transporter ATP-binding protein/permease | - |
E1E63_RS12130 | 2393983..2395746 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2396376..2396436 | + | 61 | - | - | Antitoxin |
E1E63_RS12135 | 2396453..2396560 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E1E63_RS12140 | 2396694..2397080 | - | 387 | WP_000779360.1 | flippase GtxA | - |
E1E63_RS12145 | 2397338..2398480 | + | 1143 | WP_001837638.1 | glycerate kinase | - |
E1E63_RS12150 | 2398540..2399199 | + | 660 | WP_000831301.1 | membrane protein | - |
E1E63_RS12155 | 2399381..2400592 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E1E63_RS12160 | 2400715..2401188 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T124732 WP_000482647.1 NZ_CP039992:c2396560-2396453 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T124732 NZ_CP039992:c2396560-2396453 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT124732 NZ_CP039992:2396376-2396436 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|