Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1846628..1846808 | Replicon | chromosome |
Accession | NZ_CP039992 | ||
Organism | Staphylococcus aureus strain Lr3 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E1E63_RS09050 | Protein ID | WP_001801861.1 |
Coordinates | 1846628..1846723 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1846751..1846808 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1E63_RS09020 | 1842682..1843308 | + | 627 | WP_000669025.1 | hypothetical protein | - |
E1E63_RS09025 | 1843335..1844078 | + | 744 | WP_174840254.1 | exotoxin | - |
E1E63_RS09030 | 1844105..1844857 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
E1E63_RS09035 | 1844989..1845546 | - | 558 | WP_000864141.1 | ImmA/IrrE family metallo-endopeptidase | - |
E1E63_RS09040 | 1845730..1846176 | - | 447 | WP_000747808.1 | DUF1433 domain-containing protein | - |
E1E63_RS09045 | 1846258..1846483 | - | 226 | Protein_1738 | hypothetical protein | - |
E1E63_RS09050 | 1846628..1846723 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1846751..1846808 | - | 58 | - | - | Antitoxin |
E1E63_RS09055 | 1847374..1849071 | - | 1698 | WP_000447924.1 | hypothetical protein | - |
E1E63_RS09060 | 1849049..1849903 | - | 855 | WP_001069960.1 | DNA adenine methylase | - |
E1E63_RS09065 | 1849942..1851207 | - | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1840917..1887939 | 47022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T124724 WP_001801861.1 NZ_CP039992:1846628-1846723 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T124724 NZ_CP039992:1846628-1846723 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT124724 NZ_CP039992:c1846808-1846751 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|