Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 39468..39737 | Replicon | plasmid pC2660-3-KPC |
Accession | NZ_CP039810 | ||
Organism | Klebsiella pneumoniae strain C2660 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FA957_RS29040 | Protein ID | WP_001312861.1 |
Coordinates | 39579..39737 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 39468..39533 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FA957_RS29015 | 35178..35705 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
FA957_RS29020 | 35763..35996 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
FA957_RS29025 | 36057..38080 | + | 2024 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
FA957_RS29030 | 38149..38583 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FA957_RS29035 | 38580..39299 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 39311..39535 | + | 225 | NuclAT_0 | - | - |
- | 39311..39535 | + | 225 | NuclAT_0 | - | - |
- | 39311..39535 | + | 225 | NuclAT_0 | - | - |
- | 39311..39535 | + | 225 | NuclAT_0 | - | - |
- | 39468..39533 | + | 66 | - | - | Antitoxin |
FA957_RS29040 | 39579..39737 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FA957_RS30475 | 39975..40352 | - | 378 | Protein_50 | hypothetical protein | - |
FA957_RS29050 | 40652..40948 | + | 297 | WP_001272251.1 | hypothetical protein | - |
FA957_RS29055 | 41059..41880 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
FA957_RS29060 | 42177..42824 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
FA957_RS29065 | 43101..43484 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
FA957_RS29070 | 43675..44361 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
FA957_RS29075 | 44455..44682 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..153556 | 153556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T124271 WP_001312861.1 NZ_CP039810:39579-39737 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T124271 NZ_CP039810:39579-39737 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT124271 NZ_CP039810:39468-39533 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|