Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 314767..314961 | Replicon | chromosome |
Accession | NZ_CP039434 | ||
Organism | Enterococcus faecalis strain SGAir0397 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | E7T04_RS13635 | Protein ID | WP_015543884.1 |
Coordinates | 314866..314961 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 314767..314831 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E7T04_RS01685 | 310395..312143 | + | 1749 | WP_161975114.1 | PTS transporter subunit EIIC | - |
E7T04_RS01690 | 312134..314166 | + | 2033 | Protein_289 | BglG family transcription antiterminator | - |
E7T04_RS01695 | 314177..314611 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 314767..314831 | + | 65 | NuclAT_8 | - | Antitoxin |
E7T04_RS13635 | 314866..314961 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E7T04_RS01705 | 315207..316979 | + | 1773 | WP_002405272.1 | PTS mannitol transporter subunit IICBA | - |
E7T04_RS01710 | 316994..317431 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
E7T04_RS01715 | 317446..318600 | + | 1155 | WP_010775146.1 | mannitol-1-phosphate 5-dehydrogenase | - |
E7T04_RS01720 | 318667..319782 | - | 1116 | WP_010707863.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T123933 WP_015543884.1 NZ_CP039434:c314961-314866 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T123933 NZ_CP039434:c314961-314866 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT123933 NZ_CP039434:314767-314831 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|