Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 3091722..3091936 | Replicon | chromosome |
Accession | NZ_CP039296 | ||
Organism | Enterococcus faecalis strain VE14089 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | E7T02_RS16405 | Protein ID | WP_107164701.1 |
Coordinates | 3091722..3091832 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 3091872..3091936 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E7T02_RS16355 | 3086847..3087209 | - | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
E7T02_RS16360 | 3087203..3087466 | - | 264 | WP_000245205.1 | PbsX family transcriptional regulator | - |
E7T02_RS16365 | 3087643..3088263 | + | 621 | WP_021732893.1 | recombinase family protein | - |
E7T02_RS16370 | 3088280..3088567 | + | 288 | WP_010708491.1 | hypothetical protein | - |
E7T02_RS16375 | 3088561..3088785 | + | 225 | WP_010708492.1 | hypothetical protein | - |
E7T02_RS16380 | 3088846..3089055 | + | 210 | WP_002387638.1 | hypothetical protein | - |
E7T02_RS16385 | 3089067..3089369 | + | 303 | WP_002365939.1 | hypothetical protein | - |
E7T02_RS16390 | 3089796..3091124 | + | 1329 | WP_002387639.1 | Y-family DNA polymerase | - |
E7T02_RS16395 | 3091121..3091471 | + | 351 | WP_002365943.1 | hypothetical protein | - |
E7T02_RS16405 | 3091722..3091832 | + | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 3091872..3091936 | - | 65 | - | - | Antitoxin |
- | 3091872..3091974 | - | 103 | NuclAT_2 | - | - |
- | 3091872..3091974 | - | 103 | NuclAT_2 | - | - |
- | 3091872..3091974 | - | 103 | NuclAT_2 | - | - |
- | 3091872..3091974 | - | 103 | NuclAT_2 | - | - |
E7T02_RS16410 | 3092171..3092632 | + | 462 | WP_002365946.1 | hypothetical protein | - |
E7T02_RS16415 | 3092803..3093093 | + | 291 | WP_002365947.1 | hypothetical protein | - |
E7T02_RS16420 | 3093197..3093568 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
E7T02_RS16425 | 3093561..3094406 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
E7T02_RS16435 | 3094878..3095888 | + | 1011 | WP_002365949.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T123760 WP_107164701.1 NZ_CP039296:3091722-3091832 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T123760 NZ_CP039296:3091722-3091832 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT123760 NZ_CP039296:c3091936-3091872 [Enterococcus faecalis]
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|