Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 381639..381833 | Replicon | chromosome |
Accession | NZ_CP039296 | ||
Organism | Enterococcus faecalis strain VE14089 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | E7T02_RS17160 | Protein ID | WP_015543884.1 |
Coordinates | 381738..381833 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 381639..381703 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E7T02_RS02145 | 377272..379014 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
E7T02_RS02150 | 379005..381038 | + | 2034 | WP_002387671.1 | transcription antiterminator | - |
E7T02_RS02155 | 381049..381483 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 381639..381703 | + | 65 | - | - | Antitoxin |
E7T02_RS17160 | 381738..381833 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E7T02_RS02165 | 382079..383851 | + | 1773 | WP_010706745.1 | PTS mannitol transporter subunit IICBA | - |
E7T02_RS02170 | 383866..384303 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
E7T02_RS02175 | 384318..385472 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
E7T02_RS02180 | 385539..386654 | - | 1116 | WP_002379062.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T123749 WP_015543884.1 NZ_CP039296:c381833-381738 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T123749 NZ_CP039296:c381833-381738 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT123749 NZ_CP039296:381639-381703 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|