Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2429931..2430115 | Replicon | chromosome |
Accession | NZ_CP039167 | ||
Organism | Staphylococcus aureus strain R50 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E1952_RS12585 | Protein ID | WP_000482647.1 |
Coordinates | 2430008..2430115 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2429931..2429991 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1952_RS12570 | 2425382..2425549 | - | 168 | Protein_2389 | hypothetical protein | - |
E1952_RS12575 | 2425780..2427513 | - | 1734 | WP_000486506.1 | ABC transporter ATP-binding protein/permease | - |
E1952_RS12580 | 2427538..2429301 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2429931..2429991 | + | 61 | - | - | Antitoxin |
E1952_RS12585 | 2430008..2430115 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E1952_RS12590 | 2430249..2430635 | - | 387 | WP_000779360.1 | flippase GtxA | - |
E1952_RS12595 | 2430893..2432035 | + | 1143 | WP_001837638.1 | glycerate kinase | - |
E1952_RS12600 | 2432095..2432754 | + | 660 | WP_000831301.1 | membrane protein | - |
E1952_RS12605 | 2432936..2434147 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E1952_RS12610 | 2434270..2434743 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T123633 WP_000482647.1 NZ_CP039167:c2430115-2430008 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T123633 NZ_CP039167:c2430115-2430008 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT123633 NZ_CP039167:2429931-2429991 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|