Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1517360..1517660 | Replicon | chromosome |
Accession | NZ_CP039167 | ||
Organism | Staphylococcus aureus strain R50 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | E1952_RS07585 | Protein ID | WP_073391028.1 |
Coordinates | 1517439..1517660 (-) | Length | 74 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1517360..1517415 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1952_RS07555 | 1512764..1512949 | - | 186 | WP_000470336.1 | hypothetical protein | - |
E1952_RS07560 | 1513198..1514181 | - | 984 | WP_024937002.1 | Panton-Valentine bi-component leukocidin subunit F | - |
E1952_RS07565 | 1514177..1515115 | - | 939 | WP_000239544.1 | Panton-Valentine bi-component leukocidin subunit S | - |
E1952_RS07570 | 1515505..1516959 | - | 1455 | WP_000909197.1 | N-acetylmuramoyl-L-alanine amidase | - |
E1952_RS07575 | 1516970..1517272 | - | 303 | WP_000992284.1 | phage holin | - |
E1952_RS07580 | 1517323..1517430 | + | 108 | WP_031867548.1 | hypothetical protein | - |
- | 1517352..1517491 | + | 140 | NuclAT_0 | - | - |
- | 1517352..1517491 | + | 140 | NuclAT_0 | - | - |
- | 1517352..1517491 | + | 140 | NuclAT_0 | - | - |
- | 1517352..1517491 | + | 140 | NuclAT_0 | - | - |
- | 1517360..1517415 | + | 56 | - | - | Antitoxin |
E1952_RS07585 | 1517439..1517660 | - | 222 | WP_073391028.1 | putative holin-like toxin | Toxin |
E1952_RS07590 | 1517769..1518542 | - | 774 | WP_000750407.1 | staphylococcal enterotoxin type A | - |
E1952_RS07595 | 1518963..1519337 | - | 375 | WP_000340977.1 | hypothetical protein | - |
E1952_RS07600 | 1519393..1519680 | - | 288 | WP_001262620.1 | hypothetical protein | - |
E1952_RS07605 | 1519726..1519878 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukF-PV / lukS-PV / sea / gnd | 1512764..1578737 | 65973 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 74 a.a. Molecular weight: 8689.56 Da Isoelectric Point: 10.7294
>T123620 WP_073391028.1 NZ_CP039167:c1517660-1517439 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKKITIANFGWFRWLNGY
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKKITIANFGWFRWLNGY
Download Length: 222 bp
>T123620 NZ_CP039167:c1517660-1517439 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAAATAACCATCGCTAACTTTGGTTGGTTTCGATGGTTAAATGGTTATTAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAAATAACCATCGCTAACTTTGGTTGGTTTCGATGGTTAAATGGTTATTAA
Antitoxin
Download Length: 56 bp
>AT123620 NZ_CP039167:1517360-1517415 [Staphylococcus aureus]
AAAAAGGGCAACATACGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATACGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|