Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2377530..2377714 | Replicon | chromosome |
Accession | NZ_CP039162 | ||
Organism | Staphylococcus aureus strain Lr12 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | E1950_RS12175 | Protein ID | WP_000482652.1 |
Coordinates | 2377607..2377714 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2377530..2377590 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1950_RS12160 | 2372985..2373152 | - | 168 | Protein_2330 | hypothetical protein | - |
E1950_RS12165 | 2373383..2375116 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
E1950_RS12170 | 2375141..2376904 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2377530..2377590 | + | 61 | - | - | Antitoxin |
E1950_RS12175 | 2377607..2377714 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E1950_RS12180 | 2377848..2378234 | - | 387 | WP_000779360.1 | flippase GtxA | - |
E1950_RS12185 | 2378502..2379644 | + | 1143 | WP_103152217.1 | glycerate kinase | - |
E1950_RS12190 | 2379704..2380363 | + | 660 | WP_000831298.1 | membrane protein | - |
E1950_RS12195 | 2380545..2381756 | + | 1212 | WP_103152218.1 | multidrug effflux MFS transporter | - |
E1950_RS12200 | 2381879..2382352 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T123612 WP_000482652.1 NZ_CP039162:c2377714-2377607 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T123612 NZ_CP039162:c2377714-2377607 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT123612 NZ_CP039162:2377530-2377590 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|