Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1924463..1924762 | Replicon | chromosome |
Accession | NZ_CP039162 | ||
Organism | Staphylococcus aureus strain Lr12 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | E1950_RS09685 | Protein ID | WP_072353918.1 |
Coordinates | 1924586..1924762 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1924463..1924518 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1950_RS09625 | 1920021..1920200 | + | 180 | WP_000669791.1 | hypothetical protein | - |
E1950_RS09635 | 1920511..1920771 | + | 261 | WP_001791826.1 | hypothetical protein | - |
E1950_RS09640 | 1920824..1921174 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
E1950_RS09645 | 1921685..1922020 | - | 336 | Protein_1853 | SH3 domain-containing protein | - |
E1950_RS09665 | 1922671..1923162 | - | 492 | WP_000920038.1 | staphylokinase | - |
E1950_RS09670 | 1923353..1924108 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
E1950_RS09675 | 1924120..1924374 | - | 255 | WP_000611512.1 | phage holin | - |
E1950_RS09680 | 1924426..1924533 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1924455..1924594 | + | 140 | NuclAT_0 | - | - |
- | 1924455..1924594 | + | 140 | NuclAT_0 | - | - |
- | 1924455..1924594 | + | 140 | NuclAT_0 | - | - |
- | 1924455..1924594 | + | 140 | NuclAT_0 | - | - |
- | 1924463..1924518 | + | 56 | - | - | Antitoxin |
E1950_RS09685 | 1924586..1924762 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
E1950_RS09690 | 1924905..1925279 | - | 375 | WP_000340977.1 | hypothetical protein | - |
E1950_RS09695 | 1925335..1925622 | - | 288 | WP_001262620.1 | hypothetical protein | - |
E1950_RS09700 | 1925668..1925820 | - | 153 | WP_001000058.1 | hypothetical protein | - |
E1950_RS09705 | 1925813..1929595 | - | 3783 | WP_000582128.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1920824..1970651 | 49827 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T123605 WP_072353918.1 NZ_CP039162:c1924762-1924586 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T123605 NZ_CP039162:c1924762-1924586 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT123605 NZ_CP039162:1924463-1924518 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|