Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1781939..1782119 | Replicon | chromosome |
Accession | NZ_CP039162 | ||
Organism | Staphylococcus aureus strain Lr12 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E1950_RS08820 | Protein ID | WP_001801861.1 |
Coordinates | 1781939..1782034 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1782062..1782119 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1950_RS08790 | 1777102..1777752 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
E1950_RS08795 | 1777833..1778828 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
E1950_RS08800 | 1778903..1779529 | + | 627 | WP_000669024.1 | hypothetical protein | - |
E1950_RS08805 | 1779570..1779911 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
E1950_RS08810 | 1780012..1780584 | + | 573 | WP_000414216.1 | hypothetical protein | - |
E1950_RS08815 | 1780782..1781794 | - | 1013 | Protein_1702 | IS3 family transposase | - |
E1950_RS08820 | 1781939..1782034 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1782062..1782119 | - | 58 | - | - | Antitoxin |
E1950_RS08825 | 1782157..1782258 | + | 102 | WP_001792025.1 | hypothetical protein | - |
E1950_RS08830 | 1782236..1782397 | - | 162 | Protein_1705 | transposase | - |
E1950_RS08835 | 1782388..1782882 | - | 495 | Protein_1706 | transposase | - |
E1950_RS08840 | 1783334..1784089 | - | 756 | Protein_1707 | restriction endonuclease subunit S | - |
E1950_RS08850 | 1784287..1784421 | - | 135 | WP_069479482.1 | hypothetical protein | - |
E1950_RS08855 | 1784484..1785203 | - | 720 | WP_001038752.1 | serine protease SplF | - |
E1950_RS08860 | 1785305..1785412 | + | 108 | WP_011447030.1 | hypothetical protein | - |
E1950_RS08865 | 1785361..1786080 | - | 720 | WP_001038704.1 | serine protease SplD | - |
E1950_RS08870 | 1786201..1786920 | - | 720 | WP_001038872.1 | serine protease SplC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T123601 WP_001801861.1 NZ_CP039162:1781939-1782034 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T123601 NZ_CP039162:1781939-1782034 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT123601 NZ_CP039162:c1782119-1782062 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|