Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1836320..1836500 | Replicon | chromosome |
| Accession | NZ_CP039160 | ||
| Organism | Staphylococcus aureus strain Lr6 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E1949_RS09165 | Protein ID | WP_001801861.1 |
| Coordinates | 1836320..1836415 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1836443..1836500 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E1949_RS09130 | 1832112..1832738 | + | 627 | WP_000669025.1 | hypothetical protein | - |
| E1949_RS09135 | 1832765..1833508 | + | 744 | WP_174840254.1 | exotoxin | - |
| E1949_RS09140 | 1833535..1834287 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
| E1949_RS09145 | 1834419..1834976 | - | 558 | WP_000864141.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E1949_RS09150 | 1835160..1835423 | - | 264 | Protein_1764 | hypothetical protein | - |
| E1949_RS09160 | 1835950..1836175 | - | 226 | Protein_1765 | hypothetical protein | - |
| E1949_RS09165 | 1836320..1836415 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1836443..1836500 | - | 58 | - | - | Antitoxin |
| E1949_RS09170 | 1837066..1838763 | - | 1698 | WP_000447924.1 | hypothetical protein | - |
| E1949_RS09175 | 1838741..1839595 | - | 855 | WP_001069960.1 | DNA adenine methylase | - |
| E1949_RS09180 | 1839634..1840899 | - | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1830347..1860757 | 30410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T123589 WP_001801861.1 NZ_CP039160:1836320-1836415 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T123589 NZ_CP039160:1836320-1836415 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT123589 NZ_CP039160:c1836500-1836443 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|