Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2124773..2125072 | Replicon | chromosome |
Accession | NZ_CP039156 | ||
Organism | Staphylococcus aureus strain WCUH29 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | E5491_RS11080 | Protein ID | WP_072482930.1 |
Coordinates | 2124896..2125072 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2124773..2124828 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5491_RS11030 | 2120106..2120366 | + | 261 | WP_001791826.1 | hypothetical protein | - |
E5491_RS11035 | 2120419..2120769 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
E5491_RS11040 | 2121452..2121901 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
E5491_RS11045 | 2121996..2122330 | - | 335 | Protein_2063 | SH3 domain-containing protein | - |
E5491_RS11060 | 2122981..2123472 | - | 492 | WP_000920042.1 | staphylokinase | - |
E5491_RS11065 | 2123663..2124418 | - | 756 | WP_000861040.1 | CHAP domain-containing protein | - |
E5491_RS11070 | 2124430..2124684 | - | 255 | WP_000611512.1 | phage holin | - |
E5491_RS11075 | 2124736..2124843 | + | 108 | Protein_2067 | hypothetical protein | - |
- | 2124765..2124904 | + | 140 | NuclAT_0 | - | - |
- | 2124765..2124904 | + | 140 | NuclAT_0 | - | - |
- | 2124765..2124904 | + | 140 | NuclAT_0 | - | - |
- | 2124765..2124904 | + | 140 | NuclAT_0 | - | - |
- | 2124773..2124828 | + | 56 | - | - | Antitoxin |
E5491_RS11080 | 2124896..2125072 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
E5491_RS11085 | 2125181..2125954 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
E5491_RS11090 | 2126327..2126701 | - | 375 | WP_000340977.1 | hypothetical protein | - |
E5491_RS11095 | 2126757..2127044 | - | 288 | WP_001262621.1 | hypothetical protein | - |
E5491_RS11100 | 2127090..2127242 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL | 2116923..2174844 | 57921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T123569 WP_072482930.1 NZ_CP039156:c2125072-2124896 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T123569 NZ_CP039156:c2125072-2124896 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT123569 NZ_CP039156:2124773-2124828 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|