Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1927927..1928107 | Replicon | chromosome |
Accession | NZ_CP039156 | ||
Organism | Staphylococcus aureus strain WCUH29 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E5491_RS09705 | Protein ID | WP_001801861.1 |
Coordinates | 1927927..1928022 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1928050..1928107 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5491_RS09675 | 1923090..1923740 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
E5491_RS09680 | 1923821..1924816 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
E5491_RS09685 | 1924891..1925517 | + | 627 | WP_000669024.1 | hypothetical protein | - |
E5491_RS09690 | 1925558..1925899 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
E5491_RS09695 | 1926000..1926572 | + | 573 | WP_000414216.1 | hypothetical protein | - |
E5491_RS09700 | 1926770..1927782 | - | 1013 | Protein_1841 | IS3 family transposase | - |
E5491_RS09705 | 1927927..1928022 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1928050..1928107 | - | 58 | - | - | Antitoxin |
E5491_RS09710 | 1928145..1928246 | + | 102 | WP_001792025.1 | hypothetical protein | - |
E5491_RS09715 | 1928224..1928385 | - | 162 | Protein_1844 | transposase | - |
E5491_RS09720 | 1928376..1928870 | - | 495 | Protein_1845 | transposase | - |
E5491_RS09725 | 1929322..1930551 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
E5491_RS09730 | 1930544..1932100 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
E5491_RS09735 | 1932264..1932398 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1922332..1997499 | 75167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T123565 WP_001801861.1 NZ_CP039156:1927927-1928022 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T123565 NZ_CP039156:1927927-1928022 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT123565 NZ_CP039156:c1928107-1928050 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|