Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 91835..92105 | Replicon | plasmid unnamed |
| Accession | NZ_CP038858 | ||
| Organism | Escherichia coli strain PigCaeca_2 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | E5285_RS24145 | Protein ID | WP_001312861.1 |
| Coordinates | 91947..92105 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 91835..91898 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5285_RS24560 | 87442..87648 | + | 207 | WP_096949675.1 | single-stranded DNA-binding protein | - |
| E5285_RS24120 | 87674..88213 | + | 540 | WP_000290838.1 | single-stranded DNA-binding protein | - |
| E5285_RS24125 | 88276..88509 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| E5285_RS24130 | 88575..90462 | + | 1888 | Protein_95 | ParB/RepB/Spo0J family partition protein | - |
| E5285_RS24135 | 90517..90951 | + | 435 | WP_096949674.1 | conjugation system SOS inhibitor PsiB | - |
| E5285_RS24140 | 90948..91667 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| E5285_RS24480 | 91679..91867 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 91679..91903 | + | 225 | NuclAT_0 | - | - |
| - | 91679..91903 | + | 225 | NuclAT_0 | - | - |
| - | 91679..91903 | + | 225 | NuclAT_0 | - | - |
| - | 91679..91903 | + | 225 | NuclAT_0 | - | - |
| - | 91835..91898 | - | 64 | - | - | Antitoxin |
| E5285_RS24145 | 91947..92105 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| E5285_RS24160 | 93026..93313 | + | 288 | WP_096949673.1 | hypothetical protein | - |
| E5285_RS24165 | 93431..94252 | + | 822 | WP_135927465.1 | DUF945 domain-containing protein | - |
| E5285_RS24170 | 94549..95196 | - | 648 | WP_122998621.1 | transglycosylase SLT domain-containing protein | - |
| E5285_RS24175 | 95473..95856 | + | 384 | WP_025269854.1 | relaxosome protein TraM | - |
| E5285_RS24180 | 96047..96733 | + | 687 | WP_122998622.1 | PAS domain-containing protein | - |
| E5285_RS24185 | 96827..97054 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..131158 | 131158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T123279 WP_001312861.1 NZ_CP038858:91947-92105 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T123279 NZ_CP038858:91947-92105 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT123279 NZ_CP038858:c91898-91835 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|