Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2453334..2453518 | Replicon | chromosome |
Accession | NZ_CP038819 | ||
Organism | Staphylococcus aureus strain O82 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SaO82_RS12500 | Protein ID | WP_000482647.1 |
Coordinates | 2453411..2453518 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2453334..2453394 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO82_RS12475 | 2448788..2448955 | - | 168 | WP_031901225.1 | hypothetical protein | - |
SaO82_RS12485 | 2449186..2450919 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
SaO82_RS12490 | 2450944..2452707 | - | 1764 | WP_001064823.1 | ABC transporter ATP-binding protein/permease | - |
- | 2453334..2453394 | + | 61 | - | - | Antitoxin |
SaO82_RS12500 | 2453411..2453518 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SaO82_RS12505 | 2453652..2454038 | - | 387 | WP_000779350.1 | flippase GtxA | - |
SaO82_RS12510 | 2454306..2455448 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
SaO82_RS12515 | 2455508..2456167 | + | 660 | WP_000831298.1 | membrane protein | - |
SaO82_RS12520 | 2456350..2457561 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
SaO82_RS12525 | 2457684..2458157 | - | 474 | WP_000456488.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T123224 WP_000482647.1 NZ_CP038819:c2453518-2453411 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T123224 NZ_CP038819:c2453518-2453411 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT123224 NZ_CP038819:2453334-2453394 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|