Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 5224060..5224281 | Replicon | chromosome |
Accession | NZ_CP038496 | ||
Organism | Escherichia coli O157:H7 strain TT12A |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E5F08_RS25860 | Protein ID | WP_001295224.1 |
Coordinates | 5224060..5224167 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 5224216..5224281 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5F08_RS25835 | 5219313..5220065 | - | 753 | Protein_5035 | cellulose biosynthesis protein BcsQ | - |
E5F08_RS25840 | 5220077..5220265 | - | 189 | WP_001063316.1 | YhjR family protein | - |
E5F08_RS25845 | 5220538..5222109 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E5F08_RS25850 | 5222106..5222297 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E5F08_RS25855 | 5222294..5223973 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E5F08_RS25860 | 5224060..5224167 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5224216..5224281 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5224216..5224281 | + | 66 | NuclAT_22 | - | Antitoxin |
E5F08_RS25865 | 5224643..5225914 | + | 1272 | WP_001301684.1 | amino acid permease | - |
E5F08_RS25870 | 5225944..5226948 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E5F08_RS25875 | 5226945..5227928 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E5F08_RS25880 | 5227939..5228841 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T122981 WP_001295224.1 NZ_CP038496:c5224167-5224060 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T122981 NZ_CP038496:c5224167-5224060 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT122981 NZ_CP038496:5224216-5224281 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|