Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 5058916..5059137 | Replicon | chromosome |
Accession | NZ_CP038494 | ||
Organism | Escherichia coli O157:H7 strain TT12B |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E5F07_RS24705 | Protein ID | WP_001295224.1 |
Coordinates | 5058916..5059023 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 5059072..5059137 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5F07_RS24680 | 5054169..5054921 | - | 753 | Protein_4801 | cellulose biosynthesis protein BcsQ | - |
E5F07_RS24685 | 5054933..5055121 | - | 189 | WP_001063316.1 | YhjR family protein | - |
E5F07_RS24690 | 5055394..5056965 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E5F07_RS24695 | 5056962..5057153 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E5F07_RS24700 | 5057150..5058829 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E5F07_RS24705 | 5058916..5059023 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5059072..5059137 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5059072..5059137 | + | 66 | NuclAT_22 | - | Antitoxin |
E5F07_RS24710 | 5059499..5060770 | + | 1272 | WP_001301684.1 | amino acid permease | - |
E5F07_RS24715 | 5060800..5061804 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E5F07_RS24720 | 5061801..5062784 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E5F07_RS24725 | 5062795..5063697 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T122950 WP_001295224.1 NZ_CP038494:c5059023-5058916 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T122950 NZ_CP038494:c5059023-5058916 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT122950 NZ_CP038494:5059072-5059137 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|