Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2168474..2168671 | Replicon | chromosome |
Accession | NZ_CP038461 | ||
Organism | Staphylococcus aureus strain O217 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | SaO217_RS10550 | Protein ID | WP_073392962.1 |
Coordinates | 2168567..2168671 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2168474..2168512 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO217_RS10530 | 2164649..2165314 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
SaO217_RS10535 | 2165466..2165786 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SaO217_RS10540 | 2165788..2166768 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
SaO217_RS10545 | 2167034..2168125 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
- | 2168474..2168512 | + | 39 | - | - | Antitoxin |
SaO217_RS10550 | 2168567..2168671 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
SaO217_RS10555 | 2169351..2169509 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SaO217_RS10560 | 2170168..2171025 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
SaO217_RS10565 | 2171093..2171875 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T122868 WP_073392962.1 NZ_CP038461:c2168671-2168567 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T122868 NZ_CP038461:c2168671-2168567 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT122868 NZ_CP038461:2168474-2168512 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|