Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1857665..1857845 | Replicon | chromosome |
| Accession | NZ_CP038461 | ||
| Organism | Staphylococcus aureus strain O217 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SaO217_RS08845 | Protein ID | WP_001801861.1 |
| Coordinates | 1857665..1857760 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1857788..1857845 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO217_RS08815 | 1852812..1853438 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| SaO217_RS08820 | 1853479..1853823 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| SaO217_RS08825 | 1853921..1854493 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| SaO217_RS08830 | 1854642..1856009 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| SaO217_RS08835 | 1856009..1856575 | - | 567 | WP_103148290.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SaO217_RS08840 | 1856768..1857214 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| SaO217_RS08845 | 1857665..1857760 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1857788..1857845 | - | 58 | - | - | Antitoxin |
| SaO217_RS08850 | 1857883..1857984 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| SaO217_RS08855 | 1858159..1858602 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| SaO217_RS08860 | 1858602..1859045 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| SaO217_RS08865 | 1859045..1859487 | - | 443 | Protein_1743 | DUF1433 domain-containing protein | - |
| SaO217_RS08870 | 1860012..1862432 | + | 2421 | WP_199878546.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hysA / selk | 1851046..1890273 | 39227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T122862 WP_001801861.1 NZ_CP038461:1857665-1857760 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T122862 NZ_CP038461:1857665-1857760 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT122862 NZ_CP038461:c1857845-1857788 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|