Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2460365..2460549 | Replicon | chromosome |
Accession | NZ_CP038460 | ||
Organism | Staphylococcus aureus strain B119 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SaO322_RS12755 | Protein ID | WP_000482647.1 |
Coordinates | 2460442..2460549 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2460365..2460425 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO322_RS12730 | 2455820..2455987 | - | 168 | WP_041204334.1 | hypothetical protein | - |
SaO322_RS12740 | 2456218..2457951 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
SaO322_RS12745 | 2457976..2459739 | - | 1764 | WP_001064817.1 | ABC transporter ATP-binding protein/permease | - |
- | 2460365..2460425 | + | 61 | - | - | Antitoxin |
SaO322_RS12755 | 2460442..2460549 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SaO322_RS12760 | 2460683..2461069 | - | 387 | WP_000779350.1 | flippase GtxA | - |
SaO322_RS12765 | 2461337..2462479 | + | 1143 | WP_118848162.1 | glycerate kinase | - |
SaO322_RS12770 | 2462539..2463198 | + | 660 | WP_000831299.1 | hypothetical protein | - |
SaO322_RS12775 | 2463383..2464594 | + | 1212 | WP_001191928.1 | multidrug effflux MFS transporter | - |
SaO322_RS12780 | 2464717..2465190 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T122854 WP_000482647.1 NZ_CP038460:c2460549-2460442 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T122854 NZ_CP038460:c2460549-2460442 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT122854 NZ_CP038460:2460365-2460425 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|