Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2170913..2171111 | Replicon | chromosome |
Accession | NZ_CP038460 | ||
Organism | Staphylococcus aureus strain B119 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SaO322_RS11225 | Protein ID | WP_001802298.1 |
Coordinates | 2171007..2171111 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2170913..2170951 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO322_RS11205 | 2167080..2167745 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
SaO322_RS11210 | 2167897..2168217 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SaO322_RS11215 | 2168219..2169199 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
SaO322_RS11220 | 2169465..2170556 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
- | 2170913..2170951 | + | 39 | - | - | Antitoxin |
SaO322_RS11225 | 2171007..2171111 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SaO322_RS14280 | 2171272..2171755 | - | 484 | Protein_2078 | recombinase family protein | - |
SaO322_RS11235 | 2171798..2172918 | - | 1121 | Protein_2079 | SAP domain-containing protein | - |
SaO322_RS11240 | 2173967..2174824 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
SaO322_RS11245 | 2174892..2175674 | - | 783 | WP_118848146.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T122852 WP_001802298.1 NZ_CP038460:c2171111-2171007 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T122852 NZ_CP038460:c2171111-2171007 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT122852 NZ_CP038460:2170913-2170951 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|