Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1820758..1820938 | Replicon | chromosome |
| Accession | NZ_CP038460 | ||
| Organism | Staphylococcus aureus strain B119 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SaO322_RS09080 | Protein ID | WP_001801861.1 |
| Coordinates | 1820758..1820853 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1820881..1820938 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO322_RS09045 | 1816162..1816788 | + | 627 | WP_000669034.1 | hypothetical protein | - |
| SaO322_RS09050 | 1816829..1817170 | + | 342 | WP_000627544.1 | DUF3969 family protein | - |
| SaO322_RS09055 | 1817271..1817843 | + | 573 | WP_000414210.1 | hypothetical protein | - |
| SaO322_RS09060 | 1818219..1819055 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
| SaO322_RS09070 | 1819861..1820307 | - | 447 | WP_000747806.1 | DUF1433 domain-containing protein | - |
| SaO322_RS09080 | 1820758..1820853 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1820881..1820938 | - | 58 | - | - | Antitoxin |
| SaO322_RS09085 | 1820976..1821077 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| SaO322_RS09090 | 1821063..1821242 | - | 180 | Protein_1711 | transposase | - |
| SaO322_RS09095 | 1821430..1821804 | - | 375 | WP_000695817.1 | DUF1433 domain-containing protein | - |
| SaO322_RS09100 | 1821794..1822174 | - | 381 | WP_001035978.1 | DUF1433 domain-containing protein | - |
| SaO322_RS09105 | 1822382..1822822 | - | 441 | WP_000759945.1 | DUF1433 domain-containing protein | - |
| SaO322_RS09110 | 1822867..1824480 | + | 1614 | WP_000926709.1 | hypothetical protein | - |
| SaO322_RS09115 | 1824495..1824794 | + | 300 | WP_000095391.1 | WXG100 family type VII secretion target | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T122846 WP_001801861.1 NZ_CP038460:1820758-1820853 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T122846 NZ_CP038460:1820758-1820853 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT122846 NZ_CP038460:c1820938-1820881 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|