Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 4156262..4156483 | Replicon | chromosome |
Accession | NZ_CP038428 | ||
Organism | Escherichia coli O157:H7 strain 611 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E3149_RS21030 | Protein ID | WP_001295224.1 |
Coordinates | 4156262..4156369 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4156418..4156483 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3149_RS21005 | 4151515..4152267 | - | 753 | Protein_4112 | cellulose biosynthesis protein BcsQ | - |
E3149_RS21010 | 4152279..4152467 | - | 189 | WP_001063316.1 | YhjR family protein | - |
E3149_RS21015 | 4152740..4154311 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E3149_RS21020 | 4154308..4154499 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E3149_RS21025 | 4154496..4156175 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E3149_RS21030 | 4156262..4156369 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4156418..4156483 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4156418..4156483 | + | 66 | NuclAT_22 | - | Antitoxin |
E3149_RS21035 | 4156845..4158116 | + | 1272 | WP_001301684.1 | amino acid permease | - |
E3149_RS21040 | 4158146..4159150 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E3149_RS21045 | 4159147..4160130 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E3149_RS21050 | 4160141..4161043 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T122778 WP_001295224.1 NZ_CP038428:c4156369-4156262 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T122778 NZ_CP038428:c4156369-4156262 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT122778 NZ_CP038428:4156418-4156483 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|