Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3544462..3544687 | Replicon | chromosome |
Accession | NZ_CP038416 | ||
Organism | Escherichia coli O157:H7 strain 3-5-1 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E4U90_RS18160 | Protein ID | WP_000813263.1 |
Coordinates | 3544462..3544617 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3544629..3544687 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U90_RS18125 | 3539916..3540629 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
E4U90_RS18130 | 3540767..3540963 | - | 197 | Protein_3550 | TrmB family transcriptional regulator | - |
E4U90_RS18135 | 3541250..3542068 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
E4U90_RS18140 | 3542220..3542591 | - | 372 | WP_000090264.1 | antitermination protein | - |
E4U90_RS18145 | 3542581..3542952 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
E4U90_RS18150 | 3542965..3544014 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
E4U90_RS18155 | 3544016..3544294 | - | 279 | WP_001341388.1 | hypothetical protein | - |
E4U90_RS18160 | 3544462..3544617 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3544629..3544687 | + | 59 | - | - | Antitoxin |
E4U90_RS18165 | 3544719..3544856 | + | 138 | WP_000955173.1 | hypothetical protein | - |
E4U90_RS18170 | 3545222..3545995 | + | 774 | WP_000160650.1 | alpha/beta hydrolase | - |
E4U90_RS18175 | 3546347..3546760 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
E4U90_RS18180 | 3546776..3547546 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
E4U90_RS18185 | 3547568..3548314 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
E4U90_RS18190 | 3548321..3549412 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T122590 WP_000813263.1 NZ_CP038416:c3544617-3544462 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T122590 NZ_CP038416:c3544617-3544462 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT122590 NZ_CP038416:3544629-3544687 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|