Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30094..30347 | Replicon | plasmid p493-89-1 |
Accession | NZ_CP038413 | ||
Organism | Escherichia coli O157:H7 strain 493/89 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | E3172_RS27185 | Protein ID | WP_001312851.1 |
Coordinates | 30094..30243 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 30289..30347 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3172_RS27170 | 28395..29252 | - | 858 | WP_000130951.1 | incFII family plasmid replication initiator RepA | - |
E3172_RS27175 | 29245..29319 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
E3172_RS27180 | 29562..29810 | - | 249 | WP_000083848.1 | replication regulatory protein RepA | - |
E3172_RS27185 | 30094..30243 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 30289..30347 | + | 59 | NuclAT_1 | - | Antitoxin |
- | 30289..30347 | + | 59 | NuclAT_1 | - | Antitoxin |
- | 30289..30347 | + | 59 | NuclAT_1 | - | Antitoxin |
- | 30289..30347 | + | 59 | NuclAT_1 | - | Antitoxin |
E3172_RS27190 | 30522..31112 | - | 591 | WP_000766799.1 | DUF2726 domain-containing protein | - |
E3172_RS27195 | 31150..31363 | - | 214 | Protein_32 | transcriptional regulator | - |
E3172_RS27200 | 31409..31870 | - | 462 | WP_001233860.1 | thermonuclease family protein | - |
E3172_RS27205 | 32116..32328 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
E3172_RS27210 | 32462..33022 | - | 561 | WP_000139383.1 | fertility inhibition protein FinO | - |
E3172_RS27215 | 33077..33823 | - | 747 | WP_000205743.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | papC / hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE | 1..121214 | 121214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T122523 WP_001312851.1 NZ_CP038413:c30243-30094 [Escherichia coli O157:H7]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T122523 NZ_CP038413:c30243-30094 [Escherichia coli O157:H7]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTTACTTTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTTACTTTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT122523 NZ_CP038413:30289-30347 [Escherichia coli O157:H7]
AGGAACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
AGGAACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|