Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3586382..3586607 | Replicon | chromosome |
Accession | NZ_CP038402 | ||
Organism | Escherichia coli O157:H7 strain BB24-1 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E4U87_RS18510 | Protein ID | WP_000813263.1 |
Coordinates | 3586382..3586537 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3586549..3586607 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U87_RS18475 | 3581836..3582549 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
E4U87_RS18480 | 3582687..3582883 | - | 197 | Protein_3623 | TrmB family transcriptional regulator | - |
E4U87_RS18485 | 3583170..3583988 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
E4U87_RS18490 | 3584140..3584511 | - | 372 | WP_000090264.1 | antitermination protein | - |
E4U87_RS18495 | 3584501..3584872 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
E4U87_RS18500 | 3584885..3585934 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
E4U87_RS18505 | 3585936..3586214 | - | 279 | WP_001341388.1 | hypothetical protein | - |
E4U87_RS18510 | 3586382..3586537 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3586549..3586607 | + | 59 | - | - | Antitoxin |
E4U87_RS18515 | 3586639..3586776 | + | 138 | WP_000955173.1 | hypothetical protein | - |
E4U87_RS18520 | 3587142..3587915 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
E4U87_RS18525 | 3588267..3588680 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
E4U87_RS18530 | 3588696..3589466 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
E4U87_RS18535 | 3589488..3590234 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
E4U87_RS18540 | 3590241..3591332 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T122412 WP_000813263.1 NZ_CP038402:c3586537-3586382 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T122412 NZ_CP038402:c3586537-3586382 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT122412 NZ_CP038402:3586549-3586607 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|