Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41679..41948 | Replicon | plasmid pDEC5E-2 |
Accession | NZ_CP038385 | ||
Organism | Escherichia coli O157:H7 strain DEC5E |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | E3158_RS27910 | Protein ID | WP_001312861.1 |
Coordinates | 41790..41948 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 41679..41744 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3158_RS27870 | 36906..37130 | - | 225 | WP_001427866.1 | hypothetical protein | - |
E3158_RS27875 | 37053..37244 | + | 192 | WP_032140903.1 | hypothetical protein | - |
E3158_RS27880 | 37472..37999 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
E3158_RS27885 | 38055..38288 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
E3158_RS27890 | 38347..40305 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
E3158_RS27895 | 40360..40794 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
E3158_RS27900 | 40791..41510 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
E3158_RS27905 | 41522..41710 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 41522..41746 | + | 225 | NuclAT_0 | - | - |
- | 41522..41746 | + | 225 | NuclAT_0 | - | - |
- | 41522..41746 | + | 225 | NuclAT_0 | - | - |
- | 41522..41746 | + | 225 | NuclAT_0 | - | - |
- | 41679..41744 | + | 66 | - | - | Antitoxin |
E3158_RS27910 | 41790..41948 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
E3158_RS27915 | 42302..42526 | - | 225 | WP_001340580.1 | hypothetical protein | - |
E3158_RS27920 | 42449..42640 | + | 192 | WP_032140903.1 | hypothetical protein | - |
E3158_RS27925 | 42867..43154 | + | 288 | WP_000107537.1 | hypothetical protein | - |
E3158_RS27930 | 43275..44096 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
E3158_RS27935 | 44393..45040 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
E3158_RS27940 | 45326..45709 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
E3158_RS27945 | 45903..46589 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
E3158_RS27950 | 46683..46910 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / catA1 | - | 1..80565 | 80565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T122255 WP_001312861.1 NZ_CP038385:41790-41948 [Escherichia coli O157:H7]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T122255 NZ_CP038385:41790-41948 [Escherichia coli O157:H7]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT122255 NZ_CP038385:41679-41744 [Escherichia coli O157:H7]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|