Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 5176152..5176373 | Replicon | chromosome |
Accession | NZ_CP038374 | ||
Organism | Escherichia coli O157:H7 strain F3113 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E3160_RS25420 | Protein ID | WP_001295224.1 |
Coordinates | 5176152..5176259 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 5176308..5176373 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3160_RS25395 | 5171405..5172157 | - | 753 | WP_000279530.1 | cellulose biosynthesis protein BcsQ | - |
E3160_RS25400 | 5172169..5172357 | - | 189 | WP_001063316.1 | YhjR family protein | - |
E3160_RS25405 | 5172630..5174201 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E3160_RS25410 | 5174198..5174389 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E3160_RS25415 | 5174386..5176065 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E3160_RS25420 | 5176152..5176259 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5176308..5176373 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 5176308..5176373 | + | 66 | NuclAT_22 | - | Antitoxin |
E3160_RS25425 | 5176735..5178006 | + | 1272 | WP_001306601.1 | amino acid permease | - |
E3160_RS25430 | 5178036..5179040 | - | 1005 | WP_171880495.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E3160_RS25435 | 5179037..5180020 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E3160_RS25440 | 5180031..5180933 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T122144 WP_001295224.1 NZ_CP038374:c5176259-5176152 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T122144 NZ_CP038374:c5176259-5176152 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT122144 NZ_CP038374:5176308-5176373 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|