Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
Location | 294269..294490 | Replicon | chromosome |
Accession | NZ_CP038366 | ||
Organism | Escherichia coli O157:H7 strain F6667 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E4U72_RS01430 | Protein ID | WP_001295224.1 |
Coordinates | 294383..294490 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 294269..294334 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U72_RS01410 | 289709..290611 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
E4U72_RS01415 | 290622..291605 | + | 984 | WP_171878236.1 | dipeptide ABC transporter ATP-binding protein | - |
E4U72_RS01420 | 291602..292606 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E4U72_RS01425 | 292636..293907 | - | 1272 | WP_001301684.1 | amino acid permease | - |
- | 294269..294334 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 294269..294334 | - | 66 | NuclAT_21 | - | Antitoxin |
E4U72_RS01430 | 294383..294490 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
E4U72_RS01435 | 294577..296256 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E4U72_RS01440 | 296253..296444 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E4U72_RS01445 | 296441..298012 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E4U72_RS01450 | 298285..298473 | + | 189 | WP_001063316.1 | YhjR family protein | - |
E4U72_RS01455 | 298485..298682 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
E4U72_RS01460 | 298701..299237 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T122011 WP_001295224.1 NZ_CP038366:294383-294490 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T122011 NZ_CP038366:294383-294490 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT122011 NZ_CP038366:c294334-294269 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|