Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3526810..3527035 | Replicon | chromosome |
| Accession | NZ_CP038355 | ||
| Organism | Escherichia coli O157:H7 str. F8092B | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | E4U83_RS18075 | Protein ID | WP_000813263.1 |
| Coordinates | 3526810..3526965 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3526977..3527035 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4U83_RS18040 | 3522264..3522977 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| E4U83_RS18045 | 3523115..3523311 | - | 197 | Protein_3533 | TrmB family transcriptional regulator | - |
| E4U83_RS18050 | 3523598..3524416 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| E4U83_RS18055 | 3524568..3524939 | - | 372 | WP_000090264.1 | antitermination protein | - |
| E4U83_RS18060 | 3524929..3525300 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E4U83_RS18065 | 3525313..3526362 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| E4U83_RS18070 | 3526364..3526642 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| E4U83_RS18075 | 3526810..3526965 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3526977..3527035 | + | 59 | - | - | Antitoxin |
| E4U83_RS18080 | 3527067..3527204 | + | 138 | WP_000955173.1 | hypothetical protein | - |
| E4U83_RS18085 | 3527570..3528343 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| E4U83_RS18090 | 3528695..3529108 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| E4U83_RS18095 | 3529124..3529894 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| E4U83_RS18100 | 3529916..3530662 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| E4U83_RS18105 | 3530669..3531760 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3492299..3541423 | 49124 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T121891 WP_000813263.1 NZ_CP038355:c3526965-3526810 [Escherichia coli O157:H7 str. F8092B]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T121891 NZ_CP038355:c3526965-3526810 [Escherichia coli O157:H7 str. F8092B]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT121891 NZ_CP038355:3526977-3527035 [Escherichia coli O157:H7 str. F8092B]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|