Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3488071..3488296 | Replicon | chromosome |
| Accession | NZ_CP038344 | ||
| Organism | Escherichia coli O157:H7 strain Gim1-1 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | E4U63_RS17720 | Protein ID | WP_000813263.1 |
| Coordinates | 3488071..3488226 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3488238..3488296 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4U63_RS17685 | 3483525..3484238 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| E4U63_RS17690 | 3484376..3484572 | - | 197 | Protein_3463 | TrmB family transcriptional regulator | - |
| E4U63_RS17695 | 3484859..3485677 | - | 819 | WP_000265269.1 | CPBP family intramembrane metalloprotease | - |
| E4U63_RS17700 | 3485829..3486200 | - | 372 | WP_000090264.1 | antitermination protein | - |
| E4U63_RS17705 | 3486190..3486561 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E4U63_RS17710 | 3486574..3487623 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| E4U63_RS17715 | 3487625..3487903 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| E4U63_RS17720 | 3488071..3488226 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3488238..3488296 | + | 59 | - | - | Antitoxin |
| E4U63_RS17725 | 3488328..3488465 | + | 138 | WP_000955173.1 | hypothetical protein | - |
| E4U63_RS17730 | 3488831..3489604 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| E4U63_RS17735 | 3489956..3490369 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| E4U63_RS17740 | 3490385..3491155 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| E4U63_RS17745 | 3491177..3491923 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| E4U63_RS17750 | 3491930..3493021 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T121710 WP_000813263.1 NZ_CP038344:c3488226-3488071 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T121710 NZ_CP038344:c3488226-3488071 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT121710 NZ_CP038344:3488238-3488296 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|