Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
Location | 293035..293256 | Replicon | chromosome |
Accession | NZ_CP038339 | ||
Organism | Escherichia coli O157:H7 strain H6437 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E3164_RS01420 | Protein ID | WP_001295224.1 |
Coordinates | 293149..293256 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 293035..293100 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3164_RS01400 | 288475..289377 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
E3164_RS01405 | 289388..290371 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E3164_RS01410 | 290368..291372 | + | 1005 | WP_000107028.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E3164_RS01415 | 291402..292673 | - | 1272 | WP_001356774.1 | amino acid permease | - |
- | 293035..293100 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 293035..293100 | - | 66 | NuclAT_21 | - | Antitoxin |
E3164_RS01420 | 293149..293256 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
E3164_RS01425 | 293343..295022 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E3164_RS01430 | 295019..295210 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E3164_RS01435 | 295207..296778 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E3164_RS01440 | 297051..297239 | + | 189 | WP_001063316.1 | YhjR family protein | - |
E3164_RS01445 | 297251..297448 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
E3164_RS01450 | 297467..298003 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T121619 WP_001295224.1 NZ_CP038339:293149-293256 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T121619 NZ_CP038339:293149-293256 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT121619 NZ_CP038339:c293100-293035 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|