Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3494451..3494676 | Replicon | chromosome |
Accession | NZ_CP038336 | ||
Organism | Escherichia coli O157:H7 strain LSU61 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E3165_RS17810 | Protein ID | WP_000813263.1 |
Coordinates | 3494451..3494606 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3494618..3494676 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3165_RS17775 | 3489905..3490618 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
E3165_RS17780 | 3490756..3490952 | - | 197 | Protein_3486 | TrmB family transcriptional regulator | - |
E3165_RS17785 | 3491239..3492057 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
E3165_RS17790 | 3492209..3492580 | - | 372 | WP_000090264.1 | antitermination protein | - |
E3165_RS17795 | 3492570..3492941 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
E3165_RS17800 | 3492954..3494003 | - | 1050 | WP_171877335.1 | DUF968 domain-containing protein | - |
E3165_RS17805 | 3494005..3494283 | - | 279 | WP_001341388.1 | hypothetical protein | - |
E3165_RS17810 | 3494451..3494606 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3494618..3494676 | + | 59 | - | - | Antitoxin |
E3165_RS17815 | 3494708..3494845 | + | 138 | WP_000955173.1 | hypothetical protein | - |
E3165_RS17820 | 3495211..3495984 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
E3165_RS17825 | 3496336..3496749 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
E3165_RS17830 | 3496765..3497535 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
E3165_RS17835 | 3497557..3498303 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
E3165_RS17840 | 3498310..3499401 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T121598 WP_000813263.1 NZ_CP038336:c3494606-3494451 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T121598 NZ_CP038336:c3494606-3494451 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT121598 NZ_CP038336:3494618-3494676 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|