Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
Location | 277100..277321 | Replicon | chromosome |
Accession | NZ_CP038336 | ||
Organism | Escherichia coli O157:H7 strain LSU61 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E3165_RS01330 | Protein ID | WP_001295224.1 |
Coordinates | 277214..277321 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 277100..277165 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3165_RS01310 | 272540..273442 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
E3165_RS01315 | 273453..274436 | + | 984 | WP_001196476.1 | dipeptide ABC transporter ATP-binding protein | - |
E3165_RS01320 | 274433..275437 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E3165_RS01325 | 275467..276738 | - | 1272 | WP_001306601.1 | amino acid permease | - |
- | 277100..277165 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277100..277165 | - | 66 | NuclAT_21 | - | Antitoxin |
E3165_RS01330 | 277214..277321 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
E3165_RS01335 | 277408..279087 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
E3165_RS01340 | 279084..279275 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E3165_RS01345 | 279272..280843 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E3165_RS01350 | 281116..281304 | + | 189 | WP_001063314.1 | YhjR family protein | - |
E3165_RS01355 | 281316..282068 | + | 753 | WP_000279530.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T121576 WP_001295224.1 NZ_CP038336:277214-277321 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T121576 NZ_CP038336:277214-277321 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT121576 NZ_CP038336:c277165-277100 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|