Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3496376..3496601 | Replicon | chromosome |
| Accession | NZ_CP038319 | ||
| Organism | Escherichia coli O157:H7 strain NE122 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | E3167_RS17755 | Protein ID | WP_000813263.1 |
| Coordinates | 3496376..3496531 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3496543..3496601 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3167_RS17720 | 3491830..3492543 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| E3167_RS17725 | 3492681..3492877 | - | 197 | Protein_3469 | TrmB family transcriptional regulator | - |
| E3167_RS17730 | 3493164..3493982 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| E3167_RS17735 | 3494134..3494505 | - | 372 | WP_000090264.1 | antitermination protein | - |
| E3167_RS17740 | 3494495..3494866 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3167_RS17745 | 3494879..3495928 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| E3167_RS17750 | 3495930..3496208 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| E3167_RS17755 | 3496376..3496531 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3496543..3496601 | + | 59 | - | - | Antitoxin |
| E3167_RS17760 | 3496633..3496770 | + | 138 | WP_000955173.1 | hypothetical protein | - |
| E3167_RS17765 | 3497136..3497909 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| E3167_RS17770 | 3498261..3498674 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| E3167_RS17775 | 3498690..3499460 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| E3167_RS17780 | 3499482..3500228 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| E3167_RS17785 | 3500235..3501320 | - | 1086 | WP_072141648.1 | DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T121427 WP_000813263.1 NZ_CP038319:c3496531-3496376 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T121427 NZ_CP038319:c3496531-3496376 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT121427 NZ_CP038319:3496543-3496601 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|