Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2575039..2575264 | Replicon | chromosome |
Accession | NZ_CP038319 | ||
Organism | Escherichia coli O157:H7 strain NE122 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E3167_RS12985 | Protein ID | WP_000935259.1 |
Coordinates | 2575052..2575264 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2575039..2575097 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3167_RS12935 | 2570092..2570334 | + | 243 | WP_000747948.1 | hypothetical protein | - |
E3167_RS12940 | 2570318..2570743 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
E3167_RS12945 | 2570812..2571867 | + | 1056 | WP_001356791.1 | hypothetical protein | - |
E3167_RS12950 | 2571860..2572321 | + | 462 | WP_000139447.1 | replication protein | - |
E3167_RS12955 | 2572355..2573071 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
E3167_RS12960 | 2573104..2573385 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
E3167_RS12965 | 2573382..2573609 | + | 228 | WP_000699809.1 | hypothetical protein | - |
E3167_RS12970 | 2573602..2573913 | + | 312 | WP_001289673.1 | hypothetical protein | - |
E3167_RS12975 | 2574041..2574259 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
E3167_RS12980 | 2574261..2574818 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2575039..2575097 | - | 59 | - | - | Antitoxin |
E3167_RS12985 | 2575052..2575264 | + | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
E3167_RS12990 | 2575384..2575728 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
E3167_RS12995 | 2575850..2576122 | + | 273 | WP_000191871.1 | hypothetical protein | - |
E3167_RS13000 | 2576124..2577173 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
E3167_RS13005 | 2577186..2577491 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
E3167_RS13010 | 2577554..2578108 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
E3167_RS13015 | 2578333..2578530 | + | 198 | WP_000917763.1 | hypothetical protein | - |
E3167_RS13020 | 2578666..2579379 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
E3167_RS13035 | 2579830..2580261 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2514551..2619610 | 105059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T121422 WP_000935259.1 NZ_CP038319:2575052-2575264 [Escherichia coli O157:H7]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T121422 NZ_CP038319:2575052-2575264 [Escherichia coli O157:H7]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT121422 NZ_CP038319:c2575097-2575039 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|